PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 249aa    MW: 27556.8 Da    PI: 4.6136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042522genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-17450248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++WT+eEd ll ++++q+G g W++++   g++R++k+c++rw++yl
      Lus10042522  4 MAWTEEEDNLLRKCIEQYGEGKWHRVPLLAGLNRCRKSCRLRWLNYL 50
                     58*******************************************97 PP

2Myb_DNA-binding49.31.2e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ +eE +l+v+++k+lG++ W++Ia +++ gRt++++k++w+ +
      Lus10042522  56 RGSFAPEEVDLIVKLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNCH 100
                      79999*****************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.036154IPR017930Myb domain
SMARTSM007176.7E-14252IPR001005SANT/Myb domain
PfamPF002498.8E-16450IPR001005SANT/Myb domain
SuperFamilySSF466899.54E-28597IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-21557IPR009057Homeodomain-like
CDDcd001675.22E-12550No hitNo description
PROSITE profilePS5129419.14455105IPR017930Myb domain
SMARTSM007171.5E-1455103IPR001005SANT/Myb domain
PfamPF002491.4E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2358105IPR009057Homeodomain-like
CDDcd001671.58E-1061101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGGMAWTEEE DNLLRKCIEQ YGEGKWHRVP LLAGLNRCRK SCRLRWLNYL RPNINRGSFA  60
PEEVDLIVKL HKLLGNRWSL IAGRLPGRTA NDVKNYWNCH LSKRLPSDSD QPPHISAASS  120
PAAAVEIIRP YSMNISAAST TQLSPAGSQH QPAGFQEELS SSSSSTSPAP PTPPPMLFAE  180
EQEVVDDIGN CCYRMEEFTA GFDAGEGMIE FPAAAGFGFD CDDDGSYSSK WDWDELIRDM  240
DLWGDQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-21610710110B-MYB
3zqc_A7e-2161115109MYB3
3zqc_D7e-2161115109MYB3
3zqc_G7e-2161115109MYB3
3zqc_J7e-2161115109MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602623.12e-78PREDICTED: transcription factor MYB90-like
SwissprotQ9FNV92e-56MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0B2SF142e-78A0A0B2SF14_GLYSO; Transcription factor MYB113
TrEMBLI1N2Q12e-78I1N2Q1_SOYBN; Uncharacterized protein
STRINGGLYMA18G41520.17e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-55myb domain protein 113